Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------AAVLPQLCKVEMFDKNARFVGMARGNWDK-DFVIKGHTIKCN----TRCETKDVVLPKNWSVKG-------- 1QUB Chain:A ((244-319)) SCKVPVKKATVVYQGERVKIQEKFKN--GMLHG--DKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHTDASDVKPC

General information: TITO was launched using: RESULT: Template: 1QUB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 3 0.02 0.05 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 0.02 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.377

(partial model without unconserved sides chains): PDB file : Tito_1QUB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1qub-query.scw PDB file : Tito_Scwrl_1QUB.pdb: