Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FDCYIERLQKEHMLSGMKAEPNKEAWIDGFEIWVYSNCRIHPTILPDGSIANGRF 5ZNG Chain:C ((5-58)) -DCIIQRYKDGDVNNIYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDF

General information: TITO was launched using: RESULT: Template: 5ZNG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 222 -26301 -118.47 -487.06 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain C : 0.79 3D Compatibility (PKB) : -118.47 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.162

(partial model without unconserved sides chains): PDB file : Tito_5ZNG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5zng-query.scw PDB file : Tito_Scwrl_5ZNG.pdb: