Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKPRGLTF 5X90 Chain:H ((57-78)) ---------EFVYSIHDSGSKLSTSKSQDMF-------------------------------

General information: TITO was launched using: RESULT: Template: 5X90.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 24 1530 63.73 69.52 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain H : 0.61 3D Compatibility (PKB) : 63.73 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.075

(partial model without unconserved sides chains): PDB file : Tito_5X90.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5x90-query.scw PDB file : Tito_Scwrl_5X90.pdb: