Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------------------------------WDERVCQVTVFYPGKETGTLMPHLMEPEEPIMIPKINGKRYYA--VSDANCKYKRYDLDPEGNPW----PSGLRVKGV---------------------------------------------------------------------------------------------------
1U6D Chain:X ((322-609))PKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT


General information:
TITO was launched using:
RESULT:

Template: 1U6D.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 253 -1852 -7.32 -25.72
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain X : 0.51

3D Compatibility (PKB) : -7.32
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.51
QMean score : 0.301

(partial model without unconserved sides chains):
PDB file : Tito_1U6D.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1u6d-query.scw
PDB file : Tito_Scwrl_1U6D.pdb: