Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----GDCFMGLYEAGGRNPNHIIGQETPDDSGIF-ELRRENGSVIQVKVKKCQLVAYWGWVPLGQELR 3ZO6 Chain:C ((2-69)) AFLGAAIAAGLAAVGGAIGVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIAIVISLLILF

General information: TITO was launched using: RESULT: Template: 3ZO6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 119 -8966 -75.34 -142.31 target 2D structure prediction score : 0.21 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : -75.34 2D Compatibility (Sec. Struct. Predict.) : 0.21 1D Compatibility (Hydrophobicity) : 0.64 QMean score : -0.063

(partial model without unconserved sides chains): PDB file : Tito_3ZO6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3zo6-query.scw PDB file : Tito_Scwrl_3ZO6.pdb: