Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------KRCDVGIYNSDGTGPRAYKNIDIPASCSQWDFDFEYGGVTYTVRLHYEGCRTEIIGRPQLPSHLIIRG-------
5HK3 Chain:A ((2-114))VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVN-VTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL


General information:
TITO was launched using:
RESULT:

Template: 5HK3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 518 3.08 7.72
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 3.08
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.60
QMean score : -0.006

(partial model without unconserved sides chains):
PDB file : Tito_5HK3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5hk3-query.scw
PDB file : Tito_Scwrl_5HK3.pdb: