Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----NDSDCHIWIKDNSDIVFGYSKAVTGQTAVVEISQGPHK-KEQFKFATAADQTNKKDCTAGLAGERSF-PAGWRIKTF- 1RWJ Chain:A ((1-81)) KGMTPPKTVNFKMKGVADAAFSH-EFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCHP

General information: TITO was launched using: RESULT: Template: 1RWJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 198 12091 61.06 163.39 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 61.06 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.217

(partial model without unconserved sides chains): PDB file : Tito_1RWJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1rwj-query.scw PDB file : Tito_Scwrl_1RWJ.pdb: