Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------KD---CIIQRYKDGDV--NNMYTANR-NEEITIEEYKVFVNEACHSYPVILPDRSVLSGD------------ 1C0P Chain:A ((196-290)) AEPIRGQTVLVKSPCKRCTMDSSDPASPAYIIPR-PGGEVICGGTYGVGDWDLSVNPETVQRILKHCLRLDPTISSDGTIEGIEVLRHNVGLRPAR

General information: TITO was launched using: RESULT: Template: 1C0P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 146 1131 7.74 21.33 target 2D structure prediction score : 0.89 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 7.74 2D Compatibility (Sec. Struct. Predict.) : 0.89 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.253

(partial model without unconserved sides chains): PDB file : Tito_1C0P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1c0p-query.scw PDB file : Tito_Scwrl_1C0P.pdb: