Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -GECIV-KLHDP----NGKVVSWFIALAG-----KREVKKEAAFSWSCSTNSETCEAEIPLCIVPKNFKPVGEH 2L2D Chain:A ((11-83)) SAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLPHVFNE-GRG

General information: TITO was launched using: RESULT: Template: 2L2D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 138 2050 14.85 33.06 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 14.85 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.193

(partial model without unconserved sides chains): PDB file : Tito_2L2D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2l2d-query.scw PDB file : Tito_Scwrl_2L2D.pdb: