Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----FDCTIERRLG--TQTKARARTSAKAMPEMIPAESGKYTVIAGT---RVWVYGDCRTYPTHLPDGSTISGRAF----
1FM0 Chain:D ((1-81))MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG


General information:
TITO was launched using:
RESULT:

Template: 1FM0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 206 1692 8.21 25.25
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain D : 0.64

3D Compatibility (PKB) : 8.21
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.135

(partial model without unconserved sides chains):
PDB file : Tito_1FM0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1fm0-query.scw
PDB file : Tito_Scwrl_1FM0.pdb: