Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PPSATEKCAYTIYRVASKNGLKAL--VREGDYI-----AY-KNWDQEIHGVQVHFDGEC-NPKYKSD---------VYVF------ 1Y8R Chain:C ((14-97)) --GDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG

General information: TITO was launched using: RESULT: Template: 1Y8R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 179 4610 25.75 76.83 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain C : 0.70 3D Compatibility (PKB) : 25.75 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.374

(partial model without unconserved sides chains): PDB file : Tito_1Y8R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1y8r-query.scw PDB file : Tito_Scwrl_1Y8R.pdb: