Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------KDC-----IIQRYKDGDVNNM-----YTANRNEEITIEEYKVFVNEACHSYPVILPDRSVLSGD--------------------------------------------------------------------------------------------------------------------------------------------------------------------
1QFE Chain:A ((1-252))MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA


General information:
TITO was launched using:
RESULT:

Template: 1QFE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 131 -1333 -10.17 -24.68
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain A : 0.51

3D Compatibility (PKB) : -10.17
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.51
QMean score : 0.401

(partial model without unconserved sides chains):
PDB file : Tito_1QFE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1qfe-query.scw
PDB file : Tito_Scwrl_1QFE.pdb: