Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------GECIVKLHDPNGKVVSWFIALAGKREVKKEAAFSWSCSTNSETCEAEIPLCIVPKNFKPVGEH 2MXT Chain:A ((1-85)) GSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEF--NEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREK-

General information: TITO was launched using: RESULT: Template: 2MXT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 176 3794 21.55 63.23 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 21.55 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.245

(partial model without unconserved sides chains): PDB file : Tito_2MXT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2mxt-query.scw PDB file : Tito_Scwrl_2MXT.pdb: