Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------KRCDVGIYNSDGTGPRAYKNIDIPASCSQWDFDFEYGGVTYTVR--LHYEGCRTEIIGRPQLPSHLIIRG-----------------------------------------------------------------------------------------------------------------------------------------------------
4GEK Chain:A ((32-261))WTFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERFVQPGT-QVYDLGCSLGAATLSVRRNIHHDNCKIIAIDNS---PAMIERCRRHIDAYKAPTPVDVIEGDIRDIAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA


General information:
TITO was launched using:
RESULT:

Template: 4GEK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 132 -4323 -32.75 -67.55
target 2D structure prediction score : 0.31
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : -32.75
2D Compatibility (Sec. Struct. Predict.) : 0.31
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.133

(partial model without unconserved sides chains):
PDB file : Tito_4GEK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4gek-query.scw
PDB file : Tito_Scwrl_4GEK.pdb: