Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------NGCLVKILDGHRSLGERCIEFGQEGYVTVHAEKRGYRYSLVNVQTGADCKDKGEGTNLQVVP------------------------------------------------
5LNK Chain:W ((5-143))GKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAEI-----PEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELRLKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN


General information:
TITO was launched using:
RESULT:

Template: 5LNK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 16 382 23.88 6.70
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain W : 0.56

3D Compatibility (PKB) : 23.88
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.251

(partial model without unconserved sides chains):
PDB file : Tito_5LNK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5lnk-query.scw
PDB file : Tito_Scwrl_5LNK.pdb: