Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----KDCIIQRYKDGDVNNMYTAN----RN-EEI--TIEEYKVFVNEACHSY----------PV--------ILPDRSV-------------LSGD-------------------------- 1IJY Chain:A ((5-126)) ELACQEITVPLCKGIGYEYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYER

General information: TITO was launched using: RESULT: Template: 1IJY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 134 8929 66.63 165.34 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 66.63 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.401

(partial model without unconserved sides chains): PDB file : Tito_1IJY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ijy-query.scw PDB file : Tito_Scwrl_1IJY.pdb: