Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------WDERVCQVTVFYPGKETGTLMPHLMEPEEPIMIPKINGKRYYAVSDAN---CKYKRYDLDP--EGNPWPSGLRVKGV
2HEQ Chain:A ((1-84))MAGDPLPKYWSYPVGLAVEINNNARYG--CPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYVLEHHHHHH


General information:
TITO was launched using:
RESULT:

Template: 2HEQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 8902 34.37 127.16
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : 34.37
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.195

(partial model without unconserved sides chains):
PDB file : Tito_2HEQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2heq-query.scw
PDB file : Tito_Scwrl_2HEQ.pdb: