Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----SNDKCFVSSYK-FTPDGRKVIEASQAAPGDGPITFTSTRDNFHMTIQIDANCAPRNPDDIQKELP-----
1E8O Chain:A ((1-74))PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVA


General information:
TITO was launched using:
RESULT:

Template: 1E8O.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 211 21597 102.35 337.45
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 102.35
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.218

(partial model without unconserved sides chains):
PDB file : Tito_1E8O.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1e8o-query.scw
PDB file : Tito_Scwrl_1E8O.pdb: