Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------KRCDVGIYNSDGTGPRAYKNIDIPASCSQWDFDFEYGGVTYTVR--LHYEGCRTEIIGRPQLPSHLIIRG--------------------------------------------------------------------------------------------------------------------------------------------------
4IWN Chain:A ((1-229))TFDERVAEVFPDMIQRSVPGYSNIISMIGMLAERF-VQPGTQVYDLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRHHIDAYKAPTPVDVIEGDIRDIAIENASMVVLNFTLQFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLHNAGFEHSELWFQCFNFGSLVALKAEDAA


General information:
TITO was launched using:
RESULT:

Template: 4IWN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 160 -7983 -49.89 -119.15
target 2D structure prediction score : 0.31
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : -49.89
2D Compatibility (Sec. Struct. Predict.) : 0.31
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.049

(partial model without unconserved sides chains):
PDB file : Tito_4IWN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4iwn-query.scw
PDB file : Tito_Scwrl_4IWN.pdb: