Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------------GEDGCLVEITEKTKFLGFTTGGGK-SLGNDCLPFGSQRPISVTGT-DGKTIHLNVSVSKKCKTKVEVGPPLPDNAV------------------------------------------------------- 1C4R Chain:A ((82-291)) HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPV----IERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV

General information: TITO was launched using: RESULT: Template: 1C4R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 141 9465 67.12 135.21 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 67.12 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.438

(partial model without unconserved sides chains): PDB file : Tito_1C4R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1c4r-query.scw PDB file : Tito_Scwrl_1C4R.pdb: