Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YECYVSLTINGIEHYKPEGRMEFPGATTVYDIG-----GY--GTVVIVLGDTCEPIYKTE-LK--LPQAFDFSSRIFKKR-- 1B6R Chain:A ((277-355)) NNPSVMINLIG-SDVNYD-WLKLPLV-HLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG

General information: TITO was launched using: RESULT: Template: 1B6R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 227 -2550 -11.23 -38.05 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -11.23 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.330

(partial model without unconserved sides chains): PDB file : Tito_1B6R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1b6r-query.scw PDB file : Tito_Scwrl_1B6R.pdb: