Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---KLCK-----WTVLNSEGEII--DSGSCLNTEYMKHGDIHVEFENDCTPIIFGADRVAEKVTIKG------------------------------------------------------------------------------------------------------------
1U3E Chain:M ((1-174))MEWKDIKGYEGHYQVSNT-GEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKGKTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQMSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRGKVTDVLKGHRIHHKGYTFRYKLNG


General information:
TITO was launched using:
RESULT:

Template: 1U3E.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 178 8867 49.81 158.33
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain M : 0.62

3D Compatibility (PKB) : 49.81
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.315

(partial model without unconserved sides chains):
PDB file : Tito_1U3E.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1u3e-query.scw
PDB file : Tito_Scwrl_1U3E.pdb: