Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--RCNVKIYNDKGKYQGQASDDW-GETLTIRGYTCYTDSYCKASC--DGLPAGWTAEGT-----------------------------------------------------
4YMP Chain:A ((12-130))VFDAVIKAYKDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEFHDVKVLSEDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFV


General information:
TITO was launched using:
RESULT:

Template: 4YMP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 121 7164 59.21 132.67
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain A : 0.58

3D Compatibility (PKB) : 59.21
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.58
QMean score : 0.262

(partial model without unconserved sides chains):
PDB file : Tito_4YMP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4ymp-query.scw
PDB file : Tito_Scwrl_4YMP.pdb: