Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -SPDRGLSRMCCVYKIHPGGNIW-STKKGEQAW----FRRRFSKYEVMAYDRCNLEWGFSGKPRG-LTF-- 1HR0 Chain:W ((1-71)) AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK

General information: TITO was launched using: RESULT: Template: 1HR0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 199 -3666 -18.42 -59.13 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain W : 0.69 3D Compatibility (PKB) : -18.42 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.146

(partial model without unconserved sides chains): PDB file : Tito_1HR0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1hr0-query.scw PDB file : Tito_Scwrl_1HR0.pdb: