Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GDCFMGLYEAGGRNPNHIIGQETPDDSGIFELRRENGSVIQVKVKKCQLVAYWGWVPLGQELR 1D09 Chain:B ((101-153)) -ERIDNVLVCP--NSNCISHAE-PVSS-SFAVRKRAND-IALKCKYCEKEFSHNVV-LAN---

General information: TITO was launched using: RESULT: Template: 1D09.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 193 -24362 -126.23 -459.65 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -126.23 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.147

(partial model without unconserved sides chains): PDB file : Tito_1D09.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1d09-query.scw PDB file : Tito_Scwrl_1D09.pdb: