Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------WDERVCQV-------TVFYPGKETGTLMPHLMEPEEPIMIPKINGKRYYAVSDANCKYKRYDLDP-EGNPWPSGLRVKGV-----------------------------------------------------------------------------------------------------------------
5UDF Chain:A ((13-223))DRELKNRVLGMVPQATVSSTQILTDWPELVKRVENHPHVTGVAPFTQLQGMLTAQ--GQVAGIMVTGIDPKYEKNVSIIQNHIVAGSLDSLKKGEF-------GIVLGKDMADSLGLRLNDSVTLVLPEATPSPAGVVPRFKRFKVVGIFSVGAEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAPQVADDIVKNLPSNFYATNWTYTNLFN


General information:
TITO was launched using:
RESULT:

Template: 5UDF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -2316 -26.02 -36.76
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain A : 0.53

3D Compatibility (PKB) : -26.02
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.53
QMean score : 0.302

(partial model without unconserved sides chains):
PDB file : Tito_5UDF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5udf-query.scw
PDB file : Tito_Scwrl_5UDF.pdb: