Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------YECYVSLTING-----IEHYKPEGRMEF------PGATTVYDI------GGYG---TVVIVLGDTCE----------PIYKTELKLPQAFDFSSR---IFKKR----------------- 1WMX Chain:A ((8-180)) LLDVQIFKDSPVVGWSGSGMGELETIGDTLPVDTTVTYNGLPTLRLNVQTTVQSGWWISLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGEDFVIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKIPL-RDLMKINNGFDPSSVTCLVFSKRYADPFTVWFSDIKITSE

General information: TITO was launched using: RESULT: Template: 1WMX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 214 -4515 -21.10 -65.43 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -21.10 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.269

(partial model without unconserved sides chains): PDB file : Tito_1WMX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1wmx-query.scw PDB file : Tito_Scwrl_1WMX.pdb: