Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KLCKWTVLNSEGEIIDSGSCLNTEYMKHGDIHVEFENDCTPIIFGADRVAEKVTIKG 5Y42 Chain:C ((45-93)) ---KWT-FHSDGTVRSLGKCLATNNSKFGNLVVIY--DCSKL--AAEDISWDVSVGG

General information: TITO was launched using: RESULT: Template: 5Y42.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 143 -11749 -82.16 -239.77 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain C : 0.75 3D Compatibility (PKB) : -82.16 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.216

(partial model without unconserved sides chains): PDB file : Tito_5Y42.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5y42-query.scw PDB file : Tito_Scwrl_5Y42.pdb: