Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----SPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKPRGLTF-------- 3J2P Chain:B ((1-72)) SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRH-PGFTIMAAILAYTI-GTTHFQRALIFILLTAVAP

General information: TITO was launched using: RESULT: Template: 3J2P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 45 614 13.63 10.23 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain B : 0.57 3D Compatibility (PKB) : 13.63 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.57 QMean score : -0.008

(partial model without unconserved sides chains): PDB file : Tito_3J2P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3j2p-query.scw PDB file : Tito_Scwrl_3J2P.pdb: