Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LKRVVICEVFIRMSGGLDLPIGKDFVPAGETTKIHAYTCETDTMCGAECDTPSNYRYSS 3N41 Chain:F ((359-403)) ---VTIREAEIEVEGNSQLQI--SFSTALASAEFRVQVCSTQVHCAAECH---------

General information: TITO was launched using: RESULT: Template: 3N41.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 103 -29037 -281.91 -645.27 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain F : 0.72 3D Compatibility (PKB) : -281.91 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.201

(partial model without unconserved sides chains): PDB file : Tito_3N41.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3n41-query.scw PDB file : Tito_Scwrl_3N41.pdb: