Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----FDCYIERLQKEHMLSGMKAEP-----NKEAWIDGFEIWVYSNCRIHPTIL---PDGS--IANGRF--------------------------
1JYR Chain:A ((1-96))GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI


General information:
TITO was launched using:
RESULT:

Template: 1JYR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 179 5273 29.46 95.86
target 2D structure prediction score : 0.84
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 29.46
2D Compatibility (Sec. Struct. Predict.) : 0.84
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.319

(partial model without unconserved sides chains):
PDB file : Tito_1JYR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1jyr-query.scw
PDB file : Tito_Scwrl_1JYR.pdb: