Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceSVRNPKYGDHCELTVWIHYKGKDIPLMRYYVEIGG----DLTFDEKDGAWKHCVIKTTKQACE--------ATWTGGSK----SEPCPPKNINVD---------
1R21 Chain:A ((1-100))----MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENE


General information:
TITO was launched using:
RESULT:

Template: 1R21.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 228 4359 19.12 58.11
target 2D structure prediction score : 0.53
Monomeric hydrophicity matching model chain A : 0.63

3D Compatibility (PKB) : 19.12
2D Compatibility (Sec. Struct. Predict.) : 0.53
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.222

(partial model without unconserved sides chains):
PDB file : Tito_1R21.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1r21-query.scw
PDB file : Tito_Scwrl_1R21.pdb: