Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -RICKVGI--YRAAKDNNW--RLRAARKIRISMDNTPM---QFQWD--YKDGASKEATYKVELHYE-GCEAKVVG-DQKLPAYLTIKGEI- 1CWV Chain:A ((302-392)) PTLTGILVNGQNFATDKGFPKTIFKNATFQLQMDNDVANNTQYEWSSSFTPNVSVNDQGQVTITYQTYSEVAVTAKSKKFPSYSVSYRFYP

General information: TITO was launched using: RESULT: Template: 1CWV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 281 14719 52.38 188.71 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : 52.38 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.229

(partial model without unconserved sides chains): PDB file : Tito_1CWV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1cwv-query.scw PDB file : Tito_Scwrl_1CWV.pdb: