Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PEHCFVRILKYEIPIHGDG-----------YLVGSDVNWW-VGN----QKVDFHINNDCTIQRRGGT--------QEKK------- 1DGS Chain:A ((315-400)) AEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERPI

General information: TITO was launched using: RESULT: Template: 1DGS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 144 6304 43.77 114.61 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 43.77 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.215

(partial model without unconserved sides chains): PDB file : Tito_1DGS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1dgs-query.scw PDB file : Tito_Scwrl_1DGS.pdb: