Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DTNNNRRSCYYTIFHRAGREWRQIRQTITQITPNCVVNNIRGIPKFWVDDDCTPNYQKSEEVYIRVTAEGAKNYPEPPGFPSGCSLRGR 3LPP Chain:A ((574-621)) ------------------ASWEQMEWSITGM----LEFSLFGIP-LVGADICGFVAETTEELCRRWMQLGA------------------

General information: TITO was launched using: RESULT: Template: 3LPP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 113 -7221 -63.90 -150.44 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -63.90 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.138

(partial model without unconserved sides chains): PDB file : Tito_3LPP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3lpp-query.scw PDB file : Tito_Scwrl_3LPP.pdb: