Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LKRVVICEVFIRMSGGLDLPIGKDFVPAGETTKIHAYTCETDTMCGAECDTPSNYRYSS 3N42 Chain:F ((359-408)) ---VTIREAEIEVEGNSQLQI--SFSTALASAEFRVQVCSTQVHCAAECHPPKDH----

General information: TITO was launched using: RESULT: Template: 3N42.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 106 -28665 -270.42 -573.30 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain F : 0.74 3D Compatibility (PKB) : -270.42 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.254

(partial model without unconserved sides chains): PDB file : Tito_3N42.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3n42-query.scw PDB file : Tito_Scwrl_3N42.pdb: