Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RMCILALAEKNQNPEKPSFLEDTFQEIEAPAAAMLSYGGHEIHF---ELDKNCWPRLRHGSAVPSGYSAHVY 5OAR Chain:D ((216-252)) ------------YNKTYEVVGNVYKELSD----I--FPDHWFHVGGDEIQPNCFN-----------------

General information: TITO was launched using: RESULT: Template: 5OAR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 11 -3748 -340.73 -110.24 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain D : 0.63 3D Compatibility (PKB) : -340.73 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.213

(partial model without unconserved sides chains): PDB file : Tito_5OAR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5oar-query.scw PDB file : Tito_Scwrl_5OAR.pdb: