Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LKRVVICEVFIRMSGGLDLPIGKDFVPAGETTKIHAYTCETDTMCGAECDTPSNYRYSS 3N43 Chain:F ((359-408)) ---VTIREAEIEVEGNSQLQI--SFSTALASAEFRVQVCSTQVHCAAECHPPKDH----

General information: TITO was launched using: RESULT: Template: 3N43.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 101 -27267 -269.97 -545.33 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain F : 0.74 3D Compatibility (PKB) : -269.97 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.252

(partial model without unconserved sides chains): PDB file : Tito_3N43.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3n43-query.scw PDB file : Tito_Scwrl_3N43.pdb: