Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence RFCVYYDGHLPATRVLLMYVRIGTTATITARGHEFEVEAKDQ--NCKVILTNGKQA 4M0H Chain:A ((86-115)) ------------------------QADVKVLGGSFNVKAYQEDELMAVSVRTGK--

General information: TITO was launched using: RESULT: Template: 4M0H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 -4347 -88.71 -155.25 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -88.71 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.249

(partial model without unconserved sides chains): PDB file : Tito_4M0H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4m0h-query.scw PDB file : Tito_Scwrl_4M0H.pdb: