Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGKIALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILSSTI-KPYNAEDNENFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC
1ZSO Chain:B ((-3-156))MKNTVVRIKAELENVKRLFC-DDEYLWIFNIRDSTSSLT-RDNIQFRKTDILEIPNSRGTANFMIKWTEYPKYSTINFVNTKNSCSYEEVNNNEWRDFASFECRGIELIDFFPSNNFIVED-TKGKLYYDVNLSDQNWCDYNEEHEMCVGIYNLEYEVN--


General information:
TITO was launched using:
RESULT:

Template: 1ZSO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 773 14784 19.12 95.38
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain B : 0.75

3D Compatibility (PKB) : 19.12
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.75
QMean score : -0.018

(partial model without unconserved sides chains):
PDB file : Tito_1ZSO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1zso-query.scw
PDB file : Tito_Scwrl_1ZSO.pdb: