Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------MSAENLSQMGAANVQRLVDQYGQQVIEKCPVSPVEYAFYERAAEELNSRGIKTPTLLSAD-----PHPRRLR-----LEYIPGK-----------VSQDEVSGDDILKCLSHLHHTPPDPTWVYHPHSW------PEKALEKSLALLRLPDR-----AAHQMRCFQQAGSVLFR---QKCLISGDTNAGNWGRRENGEWVLFDWERFGTGSPAIDL--APLVKGMGSRQSILQLAERYSVHCPHMPARQLATEITLAKAWIVSEVMSLLYDRNKTDFELYLNWYRETLPGWLDEAISVL
3HAM Chain:A ((1-299))MVNLDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKREFELYRFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKELHSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILNNAVLFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGRKVLKY------YQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKGVSELLQTQAEMFIF-


General information:
TITO was launched using:
RESULT:

Template: 3HAM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1056 47382 44.87 185.81
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain A : 0.59

3D Compatibility (PKB) : 44.87
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.59
QMean score : 0.288

(partial model without unconserved sides chains):
PDB file : Tito_3HAM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3ham-query.scw
PDB file : Tito_Scwrl_3HAM.pdb: