Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----ISS-PESLSDEEFEKFCCVYIVNLGKPDQREWPVL---TGKE-----VWFEHKRKKYDVMAFDSCNLVWGRRGEPKGVTF--------- 1U2F Chain:A ((1-90)) ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIF----QGQSLKIRRPHDYQPLPG

General information: TITO was launched using: RESULT: Template: 1U2F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 264 11008 41.70 164.30 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 41.70 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.421

(partial model without unconserved sides chains): PDB file : Tito_1U2F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1u2f-query.scw PDB file : Tito_Scwrl_1U2F.pdb: