Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LKRVVICEVFIRMSGGLDLPIGKDFVPAGETTKIHAYTCETDTMCGAECDTPSNYRYSS 3N44 Chain:F ((359-408)) ---VTIREAEIEVEGNSQLQI--SFSTALASAEFRVQVCSTQVHCAAECHPPKDH----

General information: TITO was launched using: RESULT: Template: 3N44.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 100 -27886 -278.86 -557.71 target 2D structure prediction score : 0.32 Monomeric hydrophicity matching model chain F : 0.74 3D Compatibility (PKB) : -278.86 2D Compatibility (Sec. Struct. Predict.) : 0.32 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.342

(partial model without unconserved sides chains): PDB file : Tito_3N44.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3n44-query.scw PDB file : Tito_Scwrl_3N44.pdb: