Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------DCFIGLYEKGG--------RNPNHIAGTEADESG--TFEVLHENYKIRVKIFKCVKQHVYDSTPSGTEIRVI-------------------------- 1KAF Chain:A ((104-211)) MEITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEI-NNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL

General information: TITO was launched using: RESULT: Template: 1KAF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 207 7667 37.04 125.69 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 37.04 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.233

(partial model without unconserved sides chains): PDB file : Tito_1KAF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1kaf-query.scw PDB file : Tito_Scwrl_1KAF.pdb: