Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceKVKKICHYSIQKLHG--KTWYQVGTGQADAGKDTHIEGTKVFFS---D------QCLPQWNN
1D1L Chain:A ((1-61))MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIH-AGRKIFLTINADGSVYAEEVKPWPSN


General information:
TITO was launched using:
RESULT:

Template: 1D1L.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 144 10459 72.63 209.17
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 72.63
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.222

(partial model without unconserved sides chains):
PDB file : Tito_1D1L.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1d1l-query.scw
PDB file : Tito_Scwrl_1D1L.pdb: