Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence NDSDCHIWIKDNSDIVFGYSKAVTGQTAVVEISQGPHKKEQFKFATAADQTNKKDCTAGLAGERSFPA---------GWRIKTF- 1GG3 Chain:A ((1-81)) --MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDN--ATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYP

General information: TITO was launched using: RESULT: Template: 1GG3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 242 -25710 -106.24 -362.11 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -106.24 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.415

(partial model without unconserved sides chains): PDB file : Tito_1GG3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1gg3-query.scw PDB file : Tito_Scwrl_1GG3.pdb: