Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------NGCLVKILDGH-RSLGERCIEFGQEGYVTVHAEKRGYRYSLVNVQTGADCKDKGEGTNLQVVP-----------------------------
2X5C Chain:A ((30-128))YKQEYDMAADLVRMLRGLGVFMHAKCPRCGAEGSVSIVETKNGYKYLVIRHPDGGTHTVPKTDISAILKELCEVKKDLEYVLKRYKEYEEEGGVKFCAE


General information:
TITO was launched using:
RESULT:

Template: 2X5C.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 191 15570 81.52 251.13
target 2D structure prediction score : 0.50
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 81.52
2D Compatibility (Sec. Struct. Predict.) : 0.50
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.413

(partial model without unconserved sides chains):
PDB file : Tito_2X5C.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2x5c-query.scw
PDB file : Tito_Scwrl_2X5C.pdb: