Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GLKDCQVSLTATSEARRSFWDTQYADYNDDVEISAGRHK---FVIHVEQGCGGSKVSGTIPPHHL 1S0Y Chain:B ((2-56)) PFIECHIA-TGLSVARKQQLIRDVIDVTNK---SIGSDPKIINVLLVEHAEANMSISGR------

General information: TITO was launched using: RESULT: Template: 1S0Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 121 -3985 -32.93 -76.63 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -32.93 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.263

(partial model without unconserved sides chains): PDB file : Tito_1S0Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1s0y-query.scw PDB file : Tito_Scwrl_1S0Y.pdb: