@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : A8K4G2_HUMAN: (2017-05-31 )
WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




CHAIN_B_2(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A81)
KSYK_HUMAN
[Raw transfer]

-

NH2_B_4(1CSY)

[Raw transfer]




CHAIN_H_8(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_J_10(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CSZ)

[Raw transfer]

-

CHAIN_B_2(2OQ1)
ZAP70_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CSZ)

[Raw transfer]

-

CHAIN_B_2(1CSY)

[Raw transfer]

-

CHAIN_L_12(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_F_6(1A81)
KSYK_HUMAN
[Raw transfer]

-

2 PsiBlast_PDB 100.00100% 0 - C- -4FL2 - KSYK_HUMAN -
1 PsiBlast_PDB 100.00100% 0 - C- -4FL3 - KSYK_HUMAN -
5 PsiBlast_PDB 91.18100%-189 - C3 -1CSZ 3.1
4 PsiBlast_PDB 90.65100%-179 - C3 -1CSY 4.2
25 PsiBlast_CBE 89.99100%-165 - C3 -1A81 4.7 KSYK_HUMAN
3 PsiBlast_PDB 89.84100%-182 - C3 -1A81 4.4 KSYK_HUMAN
23 PsiBlast_CBE 88.91100%-179 - C3 -1A81 4.0 KSYK_HUMAN
21 PsiBlast_CBE 88.27100%-179 - C3 -1A81 4.0 KSYK_HUMAN
24 PsiBlast_CBE 86.00100%-181 - C3 -1A81 3.9 KSYK_HUMAN
22 PsiBlast_CBE 85.69100%-151 - C3 -1A81 2.9 KSYK_HUMAN
13 PsiBlast_PDB 75.8551%-102 - C3 -2RSY - CSK_RAT -
14 PsiBlast_PDB 75.4750% -82 - C- -3EAZ - CSK_HUMAN -
8 PsiBlast_PDB 72.3253%-162 - C3 -4XZ0 Calc... ZAP70_HUMAN
11 PsiBlast_PDB 71.9853%-151 - C3 -2OQ1 6.0 ZAP70_HUMAN
15 PsiBlast_PDB 71.6050% -85 - C- -3EAC - CSK_HUMAN -
259 Fugue 71.3397% 78 - C3 -1CSZ 3.4
12 PsiBlast_PDB 70.8251% -85 - C3 -1K9A - CSK_RAT -
10 PsiBlast_PDB 70.0553%-154 - C3 -1M61 Calc... ZAP70_HUMAN
55 PsiBlast_CBE 68.9931%-163 - C3 -4K45 - PLCG1_RAT -
9 PsiBlast_PDB 68.2453%-156 - C3 -4XZ1 Calc... ZAP70_HUMAN
252 HHSearch 48.3835% 10 - C3 -1LKK Error LCK_HUMAN