@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B2RA70_HUMAN: (2017-06-01 )
WYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRSDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_A_4(1HCS)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

ACE_C_5(1A1A)
SRC_HUMAN
[Raw transfer]




CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_F_6(1SPS)
SRC_RSVSA
[Raw transfer]

-

3 PsiBlast_PDB 85.7981%-102 - C3 -2MRJ Calc... FYN_HUMAN
265 HHSearch 84.7682%-101 - C3 -4U1P Calc... FYN_HUMAN
6 PsiBlast_PDB 84.4781%-101 - C3 -4U1P - FYN_HUMAN -
7 PsiBlast_PDB 84.1081% -94 - C3 -2MQI Calc... FYN_HUMAN
9 PsiBlast_PDB 83.4581%-104 - C3 -3UF4 Calc... FYN_MOUSE
4 PsiBlast_PDB 83.1181%-115 - C3 -1G83 Calc... FYN_HUMAN
8 PsiBlast_PDB 82.0681% -98 - C3 -2MRK Calc... FYN_HUMAN
2 PsiBlast_PDB 81.9281% -95 - C3 -1AOU 4.7
26 PsiBlast_CBE 81.6268%-135 - C3 -1NZV 6.0
60 PsiBlast_CBE 81.4267%-115 - C3 -1HCT 2.9
61 PsiBlast_CBE 79.9267%-135 - C3 -1HCS 3.9
78 PsiBlast_CBE 79.8365%-143 - C3 -1KC2 6.1
14 PsiBlast_PDB 79.4168%-123 - C3 -1SHB 3.8
271 HHSearch 79.3767%-143 - C3 -2H8H Calc... SRC_HUMAN
27 PsiBlast_CBE 79.2968%-132 - C3 -1NZL 6.6
13 PsiBlast_PDB 79.2668%-127 - C3 -1SHA 7.2
129 PsiBlast_CBE 79.2259%-123 - C3 -1X27 3.3 ?
127 PsiBlast_CBE 79.1959%-111 - C3 -1X27 4.5 ?
1 PsiBlast_PDB 78.9481% -83 - C3 -1AOT 2.1
128 PsiBlast_CBE 78.8759%-132 - C3 -1X27 6.0 ?
45 PsiBlast_CBE 78.7067%-124 - C3 -1O4D 2.4
44 PsiBlast_CBE 78.6867%-128 - C3 -1O4E 3.4
53 PsiBlast_CBE 78.4367%-121 - C3 -1O44 8.4
39 PsiBlast_CBE 78.3467%-127 - C3 -1O4L 3.9
120 PsiBlast_CBE 78.2459%-124 - C3 -1LCJ 4.7 LCK_HUMAN
31 PsiBlast_CBE 78.2367%-131 - C3 -1BKM 6.6
37 PsiBlast_CBE 78.1667%-124 - C3 -1O4N 3.4
33 PsiBlast_CBE 78.1267%-130 - C3 -1O4R 5.7
38 PsiBlast_CBE 78.0967%-126 - C3 -1O4M 3.1
77 PsiBlast_CBE 78.0667%-126 - C3 -1F1W 6.1
63 PsiBlast_CBE 78.0467%-132 - C3 -1A1E 6.3 SRC_HUMAN
23 PsiBlast_CBE 78.0368%-124 - C3 -1IS0 4.1
28 PsiBlast_CBE 77.9968%-139 - C3 -1P13 5.1
41 PsiBlast_CBE 77.9567%-124 - C3 -1O4J 2.8
16 PsiBlast_PDB 77.8468%-115 - C3 -1SPS 2.5 SRC_RSVSA
125 PsiBlast_CBE 77.7959%-110 - C3 -1LKL 3.9 ?
42 PsiBlast_CBE 77.7867%-131 - C3 -1O4I 2.4
121 PsiBlast_CBE 77.4659%-117 - C3 -1BHF 4.9
10 PsiBlast_PDB 77.4668%-133 - C3 -1IS0 4.7 SRC_RSVSA
49 PsiBlast_CBE 77.4367%-117 - C3 -1O48 8.4
69 PsiBlast_CBE 77.3667%-131 - C3 -1A09 5.8 SRC_HUMAN
135 PsiBlast_CBE 77.3057%-130 - C3 -1IJR 8.2 LCK_HUMAN
35 PsiBlast_CBE 77.2767%-116 - C3 -1O4P 5.2
24 PsiBlast_CBE 77.1568%-118 - C3 -1SPS 5.2
20 PsiBlast_PDB 77.1068%-144 - C3 -1P13 5.4 SRC_CHICK
130 PsiBlast_CBE 77.0759%-105 - C3 -1X27 5.9 ?
59 PsiBlast_CBE 77.0667%-149 - C3 -1SHD 6.2
30 PsiBlast_CBE 77.0368%-114 - C3 -1A1A 4.5 SRC_HUMAN
126 PsiBlast_CBE 77.0259%-115 - C3 -1X27 5.4 ?
124 PsiBlast_CBE 77.0059%-112 - C3 -1LCK 3.0 LCK_HUMAN
81 PsiBlast_CBE 76.8667%-123 - C3 -1O4G 3.8
47 PsiBlast_CBE 76.8067%-117 - C3 -1O4A 7.1
262 HHSearch 76.7959%-112 - C3 -1LKK 7.2 LCK_HUMAN
122 PsiBlast_CBE 76.7959%-112 - C3 -1LKK 7.2 LCK_HUMAN
134 PsiBlast_CBE 76.7259%-123 - C3 -1CWD 4.1 ?
48 PsiBlast_CBE 76.6967%-115 - C3 -1O49 6.6
56 PsiBlast_CBE 76.5167%-128 - C3 -1O41 2.7
72 PsiBlast_CBE 76.4467%-118 - C3 -1A07 3.5
82 PsiBlast_CBE 76.4067%-128 - C3 -1O4F 2.5
34 PsiBlast_CBE 76.3567%-129 - C3 -1O4Q 3.5
137 PsiBlast_CBE 76.2657%-137 - C3 -1FBZ 6.8 LCK_HUMAN
46 PsiBlast_CBE 76.2167%-113 - C3 -1O4B 5.9
43 PsiBlast_CBE 76.1467%-126 - C3 -1O4H 3.7
131 PsiBlast_CBE 76.1359%-119 - C3 -1X27 4.0
65 PsiBlast_CBE 76.0467%-119 - C3 -1A1C 6.5 SRC_HUMAN
71 PsiBlast_CBE 75.8767%-121 - C3 -1A08 5.7 SRC_HUMAN
52 PsiBlast_CBE 75.8567%-127 - C3 -1O45 7.3
51 PsiBlast_CBE 75.7767%-120 - C3 -1O46 7.9
73 PsiBlast_CBE 75.7367%-126 - C3 -1A07 3.4 SRC_HUMAN
136 PsiBlast_CBE 75.7157%-138 - C3 -1FBZ 6.6 ?
40 PsiBlast_CBE 75.5767%-131 - C3 -1O4K 3.5
29 PsiBlast_CBE 75.5468%-109 - C3 -1A1A 6.3
132 PsiBlast_CBE 75.2059%-137 - C3 -1CWE 5.2 ?
25 PsiBlast_CBE 75.0168%-138 - C3 -1SPS 4.5 SRC_RSVSA
54 PsiBlast_CBE 74.6667%-120 - C3 -1O43 6.4
50 PsiBlast_CBE 74.6567%-112 - C3 -1O47 7.9
133 PsiBlast_CBE 74.5359%-126 - C3 -1CWE 5.1 ?
55 PsiBlast_CBE 74.5167%-116 - C3 -1O42 7.4
67 PsiBlast_CBE 74.0667%-121 - C3 -1A1B 5.9 SRC_HUMAN
12 PsiBlast_PDB 74.0468%-135 - C3 -1SKJ 6.9
66 PsiBlast_CBE 73.9867%-123 - C3 -1A1B 5.9
70 PsiBlast_CBE 73.3367%-120 - C3 -1A08 6.4
68 PsiBlast_CBE 73.3367%-126 - C3 -1A09 5.6
36 PsiBlast_CBE 73.3067%-116 - C3 -1O4O 3.0
64 PsiBlast_CBE 72.8767%-118 - C3 -1A1C 6.9
62 PsiBlast_CBE 71.3667%-115 - C3 -1A1E 6.7
5 PsiBlast_PDB 68.8581% -46 - C3 -4U17 2.3 FYN_HUMAN
280 Fugue 68.1681% 118 - C3 -1AOU 4.7
21 PsiBlast_CBE 68.0981% -46 - C3 -4U17 2.9 ?